SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000004143 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000004143
Domain Number 1 Region: 327-584
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.9e-98
Family STAT DNA-binding domain 0.0000625
Further Details:      
 
Domain Number 2 Region: 136-332
Classification Level Classification E-value
Superfamily STAT 1.84e-54
Family STAT 0.00016
Further Details:      
 
Domain Number 3 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.16e-38
Family Transcription factor STAT-4 N-domain 0.00041
Further Details:      
 
Domain Number 4 Region: 585-707
Classification Level Classification E-value
Superfamily SH2 domain 1.09e-33
Family SH2 domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000004143   Gene: ENSMUSG00000020919   Transcript: ENSMUST00000004143
Sequence length 786
Comment pep:known chromosome:NCBIM37:11:100642045:100712038:-1 gene:ENSMUSG00000020919 transcript:ENSMUST00000004143
Sequence
MAMWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQSTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLITQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLGQLNPQERMSRETALQQKQVSLETWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFDSQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNI
SSNHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAADGYVKPQIKQVVPEFANASTDAGS
GATYMDQAPSPVVCPQAHYNMYPPNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQW
IPHAQS
Download sequence
Identical sequences P42232
ENSMUSP00000004143 10090.ENSMUSP00000004143 ENSMUSP00000004143 ENSMUSP00000102981 NP_001107035.1.92730 NP_035619.3.92730 XP_017169892.1.92730 ENSMUSP00000004143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]