SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000004959 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000004959
Domain Number 1 Region: 29-140
Classification Level Classification E-value
Superfamily SH2 domain 9.96e-32
Family SH2 domain 0.0000298
Further Details:      
 
Domain Number 2 Region: 155-215
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-22
Family SH3-domain 0.00041
Further Details:      
 
Domain Number 3 Region: 4-41
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000372
Family SH3-domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000004959   Gene: ENSMUSG00000004837   Transcript: ENSMUST00000004959
Sequence length 217
Comment pep:known chromosome:NCBIM37:11:61466767:61486286:1 gene:ENSMUSG00000004837 transcript:ENSMUST00000004959
Sequence
MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGAEGFVPKNYIRVKPHPW
YSGRISRQLAEETLMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFL
WEEKFNSLNELVDFYRTTTIAKRRQIFLCDEQPLIKPSRACFAQAQFDFSAQDPSQLSLR
RGDIVEVVEREDPHWWRGRAGGRLGFFPRSYVQPVHL
Download sequence
Identical sequences Q9CX99
ENSMUSP00000004959 ENSMUSP00000004959 NP_082093.1.92730 10090.ENSMUSP00000004959 ENSMUSP00000004959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]