SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000005262 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000005262
Domain Number - Region: 224-252
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0133
Family SAM (sterile alpha motif) domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000005262   Gene: ENSMUSG00000005131   Transcript: ENSMUST00000005262
Sequence length 315
Comment pep:known chromosome:NCBIM37:9:53213391:53240908:1 gene:ENSMUSG00000005131 transcript:ENSMUST00000005262
Sequence
MSVKHIQDNSNQEIAARIIQRAWKTFLNVSVYQHFKSLIDLRRQGEPRQIVRYINPKEAQ
LLDAAAGVQVRFRLGGVRFPPEIYYKIFTHRHIEDLCANSPRDYTKLPARYTSHNKDDPP
QVEDNSGWYRRVENNGWRPVSYRFWMPLESGVVDSTKESEFHFSKLKRKQDLEKKRKIKK
IDWMRQMYYMGSLEAKATDNETLGLIHKATKGLIKSIEDGGVDSVMEWEVDEVLNWTNTL
NFDEYIASWRETATSNSSANLKDVKLQRIQKSLQSNIYGDEAKQAEESLYDDSTYYENAY
TKQFTRLTPDSMFGM
Download sequence
Identical sequences Q9D4W2
ENSMUSP00000005262 ENSMUSP00000005262 ENSMUSP00000005262 NP_083523.1.92730 XP_006510715.1.92730 XP_006510716.1.92730 XP_006510717.1.92730 XP_017169167.1.92730 10090.ENSMUSP00000005262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]