SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000005839 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000005839
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-27
Family SH2 domain 0.0000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000005839   Gene: ENSMUSG00000005696   Transcript: ENSMUST00000005839
Sequence length 126
Comment pep:known chromosome:NCBIM37:X:39855739:39875270:1 gene:ENSMUSG00000005696 transcript:ENSMUST00000005839
Sequence
MDAVTVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYQGYIYTYRVSQTE
TGSWSAETAPGVHKRFFRKVKNLISAFQKPDQGIVTPLQYPVEKSSGRGPQAPTGRRDSD
ICLNAP
Download sequence
Identical sequences O88890 Q544F1
ENSMUSP00000005839 10090.ENSMUSP00000005839 ENSMUSP00000005839 ENSMUSP00000005839 ENSMUSP00000141070 NP_035494.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]