SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000006254 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000006254
Domain Number 1 Region: 96-233
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.75e-40
Family Cap-Gly domain 0.00000623
Further Details:      
 
Domain Number 2 Region: 9-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.32e-27
Family Ubiquitin-related 0.00000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000006254   Gene: ENSMUSG00000006095   Transcript: ENSMUST00000006254
Sequence length 244
Comment pep:known chromosome:NCBIM37:7:31009150:31017291:-1 gene:ENSMUSG00000006095 transcript:ENSMUST00000006254
Sequence
MEVTGISAPTVMVFISSSLNSFRSEKRYSRSLTIAEFKCKLELVVGSPASCMELELYGAD
DKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGVRLGEYEDVSKVEKYEISPEAYERRQNT
VRSFMKRSKLGPYNEELRAQQEAEAAQRLSEEKAQASAISVGSRCEVRAPDHSLRRGTVM
YVGLTDFKPGYWVGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPSAVTVGDFPEEDYG
LDEM
Download sequence
Identical sequences Q9D1E6
ENSMUSP00000006254 ENSMUSP00000006254 10090.ENSMUSP00000006254 NP_079824.2.92730 ENSMUSP00000006254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]