SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000007602 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000007602
Domain Number 1 Region: 31-180
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.62e-35
Family Mannose 6-phosphate receptor domain 0.000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000007602   Gene: ENSMUSG00000007458   Transcript: ENSMUST00000007602
Sequence length 278
Comment pep:known chromosome:NCBIM37:6:122258738:122267698:1 gene:ENSMUSG00000007458 transcript:ENSMUST00000007602
Sequence
MFPFSGCWRTELLLLLLLAVAVRESWQIEEKSCDLVGEKDKESKNEVALLERLRPLFNKS
FESTVGQGSDTYSYIFRVCREASNHSSGAGLVQINKSNDKETVVGRINETHIFNGSNWIM
LIYKGGDEYDNHCGKEQRRAVVMISCNRHTLAANFNPVSEERGKVQDCFYLFEMDSSLAC
SPEVSHLSVGSILLVIFASLVAVYIIGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADG
CDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM
Download sequence
Identical sequences P24668 Q3UKQ5
NP_034879.2.92730 10090.ENSMUSP00000108229 ENSMUSP00000007602 ENSMUSP00000007602 ENSMUSP00000108229 ENSMUSP00000007602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]