SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000009138 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000009138
Domain Number 1 Region: 73-244,281-430
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-80
Family Protein kinases, catalytic subunit 0.00000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000009138   Gene: ENSMUSG00000024006   Transcript: ENSMUST00000009138
Sequence length 465
Comment pep:known chromosome:NCBIM37:17:29107830:29144882:-1 gene:ENSMUSG00000024006 transcript:ENSMUST00000009138
Sequence
MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDE
EKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKIL
RKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMK
KDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKA
HRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYN
KLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPVSEKAKGLILRF
CCEWEHRIGAPGVEEIKNNLFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILK
PTVTTSSHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
Download sequence
Identical sequences Q91VJ4
ENSMUSP00000009138 ENSMUSP00000009138 ENSMUSP00000113657 NP_598876.1.92730 ENSMUSP00000009138 10090.ENSMUSP00000009138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]