SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000010940 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000010940
Domain Number 1 Region: 52-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.66e-47
Family Ankyrin repeat 0.00022
Further Details:      
 
Domain Number 2 Region: 275-337
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000766
Family SAM (sterile alpha motif) domain 0.018
Further Details:      
 
Domain Number 3 Region: 245-300,385-418
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000994
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000010940   Gene: ENSMUSG00000010796   Transcript: ENSMUST00000010940
Sequence length 475
Comment pep:known chromosome:NCBIM37:6:18000964:18059057:-1 gene:ENSMUSG00000010796 transcript:ENSMUST00000010940
Sequence
MAAGTLRGLAVAGGGESSDSEDDGWDIGYLDRSSQKLKRSLPVEEKNETFKKALTTGDIS
LVKELLDSGINVDSSFRYGWTPLMYAASVANAELVRFLLDRGANASFDKDKLTILISACS
ARGSEEQVLKCVELLLSRNADPNTACRRLMTPIMYAARDGHTQVVALLVAHGAEVNAQDE
NGYTALTWAARQGHKNVILKLLELGANKMLQTKDGRTPSEIAKRNKHLEIFNFLSLTLNP
LEGKLQQLTKEETICKLLATDSDKEKDHIFSPYTAFGDLEIFLHGLGLEHMTDSLKEKDI
TLRHLLTMKKDELTKNGIASKDQQKILAALKELEVEEINFGKLPEVTKLEISGDEFLNFL
LKLNKQCGHLITAVQNIITELPVNSHKIVLEWASPRNFTSVCEELVSNVEDLNEEVCRLK
ELIQKMQNERENDPTHIPLVEEVSTWKTRILKRSAVTVCGFGLLLFIGKLTLQRK
Download sequence
Identical sequences Q8VD46
10090.ENSMUSP00000010940 ENSMUSP00000010940 ENSMUSP00000010940 ENSMUSP00000010940 NP_076218.3.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]