SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000013807 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000013807
Domain Number 1 Region: 20-185
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.76e-49
Family Dual specificity phosphatase-like 0.0000000227
Further Details:      
 
Domain Number 2 Region: 188-349
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.16e-40
Family PLC-like (P variant) 0.000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000013807   Gene: ENSMUSG00000013663   Transcript: ENSMUST00000013807
Sequence length 403
Comment pep:known chromosome:NCBIM37:19:32831987:32900650:1 gene:ENSMUSG00000013663 transcript:ENSMUST00000013807
Sequence
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMY
FEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEI
DSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEAS
SSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHSQITKV
Download sequence
Identical sequences O08586
10090.ENSMUSP00000013807 ENSMUSP00000013807 ENSMUSP00000013807 NP_032986.1.92730 XP_003510358.1.69978 XP_006996261.1.50099 XP_007632109.1.28591 XP_021042368.1.100879 ENSMUSP00000013807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]