SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000014022 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000014022
Domain Number 1 Region: 103-162
Classification Level Classification E-value
Superfamily RING/U-box 1.77e-18
Family RING finger domain, C3HC4 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000014022   Gene: ENSMUSG00000013878   Transcript: ENSMUST00000014022
Sequence length 286
Comment pep:known chromosome:NCBIM37:8:27229840:27254343:1 gene:ENSMUSG00000013878 transcript:ENSMUST00000014022
Sequence
MQRYWRFQDNKIQDICFGVLGESWIQRPVMARYYSEGQSLQQDDSFIEGVSDQVLVAVVV
SLALTATLLYALLRNVQQNIHPENQELVRVLREQFQTEQDVPAPARQQFYTEMYCPICLH
QASFPVETNCGHLFCGSCIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVIRL
RQDVNDYNRRFSGQPRSIMERIMDLPTLLRHAFREVFSVGGLFWMFRIRIMLCLMGAFFY
LISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR
Download sequence
Identical sequences Q8CBG9
ENSMUSP00000014022 NP_084241.1.92730 XP_006509278.1.92730 XP_006509279.1.92730 XP_006509280.1.92730 XP_006509281.1.92730 ENSMUSP00000014022 10090.ENSMUSP00000014022 ENSMUSP00000014022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]