SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000016231 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000016231
Domain Number 1 Region: 278-412
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.88e-50
Family ets domain 0.00000254
Further Details:      
 
Domain Number 2 Region: 99-197
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.46e-30
Family Pointed domain 0.0000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000016231   Gene: ENSMUSG00000016087   Transcript: ENSMUST00000016231
Sequence length 452
Comment pep:known chromosome:NCBIM37:9:32229793:32348974:-1 gene:ENSMUSG00000016087 transcript:ENSMUST00000016231
Sequence
MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQ
PVRVNVKREYDHMNGSRESPVDCSVSKCNKLVGGGEANPMNYNSYMDEKNGPPPPNMTTN
ERRVIVPADPTLWTQEHVRQWLEWAIKEYGLMEIDTSFFQNMDGKELCKMNKEDFLRATS
AYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLNVKEDPSYDSVRRGAWNNNMNSGLNK
SPLLGGSQTMGKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCI
TWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF
DFHGIAQALQPHPTETSMYKYPSDISYMPSYHAHQQKVNFVPSHPSSMPVTSSSFFGAAS
QYWTSPTAGIYPNPSVPRHPNTHVPSHLGSYY
Download sequence
Identical sequences P26323 Q544B3
ENSMUSP00000016231 NP_032052.1.92730 10090.ENSMUSP00000016231 ENSMUSP00000016231 ENSMUSP00000016231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]