SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000017544 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000017544
Domain Number 1 Region: 278-384
Classification Level Classification E-value
Superfamily SH3-domain 1.21e-23
Family SH3-domain 0.00084
Further Details:      
 
Domain Number 2 Region: 96-162
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000015
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000017544   Gene: ENSMUSG00000017400   Transcript: ENSMUST00000017544
Sequence length 408
Comment pep:known chromosome:NCBIM37:11:97897937:97914776:-1 gene:ENSMUSG00000017400 transcript:ENSMUST00000017544
Sequence
MTEMSEKENEPDDAATHTPPGTVSTLQETKLQRFKRSLSLKTILRSKSVENFFLRSGSEL
KCPTEVLLTPPTPLPPPSPPPASTDRGLPTPTPSPCPVPRPLAPLKPVRLHSFQEHVFKR
ASPCELCHQLIVGNSKQGLRCKTCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVH
APPPACAMNKESPPTGTSGKVDPVYETLRYGTSLALMNRSSFSSTSESPTRSLSERDELT
EDGEGSIRSSEEGPGDSVFTAPAESEGSGPEEKSPGQQPPKLPLRKDVGPMYSYVALYKF
LPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPFS
GNKEQGYMSLKENQICVGVSRSKDSDGFIRVSSGKKRGLVPADSLAEI
Download sequence
Identical sequences Q8R1B0
ENSMUSP00000017544 10090.ENSMUSP00000017544 ENSMUSP00000017544 ENSMUSP00000017544 NP_666140.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]