SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000017751 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000017751
Domain Number 1 Region: 551-691
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-44
Family Phosphotyrosine-binding domain (PTB) 0.0000162
Further Details:      
 
Domain Number 2 Region: 413-536
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-20
Family SH2 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000017751   Gene: ENSMUSG00000017607   Transcript: ENSMUST00000017751
Sequence length 696
Comment pep:known chromosome:NCBIM37:11:98926992:98950620:-1 gene:ENSMUSG00000017607 transcript:ENSMUST00000017751
Sequence
MSSSLLAGGHMVSLTPCEESRMALHPTPSPGLPALCPYYTTESWGTQPLMAPTLRKGSSD
RLQQAQQAEARAHCLLQGPGEQASGASQDLESCIDFSLEALNQMILEIDPTFQLLPSGTA
GPQAESTNSIMSRNKKEEPEALDIKYIEVTSTRSRYLDGPQRCSSPCATPPFGSPRSGSL
FLSRDIPRETRSSSNESLIFSGNQGRGPSPLTPSSLSNAIPCRESRTSGSPLATPPGWEK
GLRAPQRGSRVSILSASPVSDVSYVFGSNQSLPHSSLSSYPSSSRSLGSPASSSSSLHSL
DRGSQCGRPSDAQAPSNPILGMGQPQAVQSTPVAKEQASSCPASVTNSMADIPIVLINGS
PEPQSPPAQRTPGHQDSVQSRVTSPSHLCQAIKSPSKTLPDVPLPASPDGPAKDMQPTMK
FVMDTSKYWFKPSITREQAINLLRTEKPGAFVIRDSSSYRGSFGLALKVQETSASAPNRP
GEDSSDLIRHFLIESSAKGVHLKGADEEPYFGSLSSFVCQHSIMALALPCKLTIPQKELG
GAEPASDSPTHGQTSCLKISAGCHTLYLSSVSVETLSGALAVQKAISVTLERDVLPTPTV
VHFKVTEQGITLTDVQRKVFFRRHYPLSALRFCGMDPEQRKWQKYCKPSRIFGFVAKSQT
EPQENVCHLFAEYDAVQPASQVISLVTALLQDTERM
Download sequence
Identical sequences Q8BZ33
ENSMUSP00000017751 ENSMUSP00000017751 NP_766152.2.92730 ENSMUSP00000017751 10090.ENSMUSP00000017751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]