SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000017920 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000017920
Domain Number 1 Region: 10-120,161-187
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-26
Family SH2 domain 0.0000024
Further Details:      
 
Domain Number 2 Region: 61-79,135-227
Classification Level Classification E-value
Superfamily SH3-domain 4e-25
Family SH3-domain 0.0000291
Further Details:      
 
Domain Number 3 Region: 209-300
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000144
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000017920   Gene: ENSMUSG00000017776   Transcript: ENSMUST00000017920
Sequence length 304
Comment pep:known chromosome:NCBIM37:11:75492761:75519567:1 gene:ENSMUSG00000017776 transcript:ENSMUST00000017920
Sequence
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVAR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
Download sequence
Identical sequences Q5ND51 Q64010
ENSMUSP00000017920 ENSMUSP00000017920 10090.ENSMUSP00000017920 mmt008000518.1 ENSMUSP00000017920 NP_598417.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]