SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000018792 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000018792
Domain Number 1 Region: 13-170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.63e-45
Family Dual specificity phosphatase-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000018792   Gene: ENSMUSG00000018648   Transcript: ENSMUST00000018792
Sequence length 198
Comment pep:known chromosome:NCBIM37:11:83861543:83882303:-1 gene:ENSMUSG00000018648 transcript:ENSMUST00000018792
Sequence
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRASVASNWHLLQARGITCVINAT
IEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGVSRSAT
LCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYESQLFGKSSVKMVQTPYGI
IPDVYEKESRHLMPYWGI
Download sequence
Identical sequences Q542U4 Q9JLY7
ENSMUSP00000018792 NP_062793.2.92730 XP_006533859.1.92730 XP_006533860.1.92730 XP_006533861.1.92730 XP_006533862.1.92730 ENSMUSP00000018792 ENSMUSP00000098271 ENSMUSP00000103736 ENSMUSP00000130624 ENSMUSP00000018792 10090.ENSMUSP00000103736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]