SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000019443 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000019443
Domain Number 1 Region: 775-843
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000006
Family IBR domain 0.0000158
Further Details:      
 
Domain Number 2 Region: 65-165
Classification Level Classification E-value
Superfamily PUG domain-like 0.000000000000209
Family PUG domain 0.0039
Further Details:      
 
Domain Number 3 Region: 692-757
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000274
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 4 Region: 855-927
Classification Level Classification E-value
Superfamily RING/U-box 0.0000118
Family RING finger domain, C3HC4 0.038
Further Details:      
 
Domain Number 5 Region: 344-371
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000353
Family Ran binding protein zinc finger-like 0.003
Further Details:      
 
Domain Number 6 Region: 404-430
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000667
Family Ran binding protein zinc finger-like 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000019443
Domain Number - Region: 569-607
Classification Level Classification E-value
Superfamily UBA-like 0.00151
Family UBA domain 0.012
Further Details:      
 
Domain Number - Region: 212-243
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0126
Family TFIIH p44 subunit cysteine-rich domain 0.028
Further Details:      
 
Domain Number - Region: 298-323
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.051
Family Ran binding protein zinc finger-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000019443   Gene: ENSMUSG00000047098   Transcript: ENSMUST00000019443
Sequence length 1066
Comment pep:known chromosome:NCBIM37:14:56210545:56222530:1 gene:ENSMUSG00000047098 transcript:ENSMUST00000019443
Sequence
MPGDEERGFLAAREELASALRWDSAQVFPLEQLMPLLATSLPPAARYLQLDAGRLVRCNA
HGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRSVKFNNPVFRSTVDAVQGGRDVLRL
YGYTEERPDGLSFPEGQEEPDEYQVAVVTLEVLLLRTELSLLLQNTHPRQNALDQLLRES
VEDGMLQLSEFHPLLREIVPGPRPSAQGSTPGPCFLCGSAPGTLHCPACNQVSCPACDIL
FHGHPSRAHHLRQALPGSHQTASLSSSLPASSQPRPPSSSLALGDSSLSSPDPANACLPW
HCLTCATLNEPWAVFCAVCSQPKGCKVPGIEGSHGTGGLEPEPARDQWACQSCTFENEAA
AVLCAICERPRLAQPPSLVVDSHDAGVCQQSLKQEDPLLTAAQPQVWYCDHCTFCNSGPV
WVCAMCNRTRDPIPTQPALQSYPSSLEKGRPKPGSSQHLGSSLPASCGDPEKQRQDKMRK
EGLQLVSMIQEGETAGASPEEVFSALQYSGTEVPLQWLRSELSYVLEMVAELAGQQDPEL
GAFSCQEARKAWLDRHGNLDEAVEECVRARRRKVHELQSLGFGPKEGSLQALFQHGGDVA
RALTELQRQRLEPFHQRLWDRDPEPTPCWDGLDRQSLVRRLLAVYTLPSWGRAELALALL
QETPRNYELLDVVEAVRHSQDRAFLRRLLAQECAVCGWALPRNRMQALISCECTICPECF
RQHFTIALKEKHITDMVCPACGRPDLTDDAQLLSYFSTLDIQLRESLDPDAYALFHKKLT
EAVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQN
WKRTNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFY
AKNKCPDPNCKVKKSLHGHHPRDCLFYLRDWTAARLQKLLQDNNVMFNTEPPAGTRAVPG
GGCRVMEQKEVHSGFRDEACGKETPPGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEEL
ETATIRYLHLAPQPADGEDLPAYQARLLQKLREEVPLGQSIARRRK
Download sequence
Identical sequences Q924T7
ENSMUSP00000019443 ENSMUSP00000019443 NP_919327.2.92730 ENSMUSP00000019443 10090.ENSMUSP00000019443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]