SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000019967 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000019967
Domain Number 1 Region: 388-612
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-34
Family Calponin-homology domain, CH-domain 0.00038
Further Details:      
 
Domain Number 2 Region: 85-236,380-466
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.051
Further Details:      
 
Domain Number 3 Region: 709-740
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000157
Family LIM domain 0.00074
Further Details:      
 
Domain Number 4 Region: 676-708
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000158
Family LIM domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000019967   Gene: ENSMUSG00000019823   Transcript: ENSMUST00000019967
Sequence length 1048
Comment pep:known chromosome:NCBIM37:10:41196120:41206836:1 gene:ENSMUSG00000019823 transcript:ENSMUST00000019967
Sequence
MASPASTNPAHDHFETFVQAQLCQDVLSSFQGLCRALGVESGGGLSQYHKIKAQLNYWSA
KSLWAKLDKRASQPVYQQGQACTNTKCLVVGAGPCGLRAAVELALLGARVVLVEKRIKFS
RHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVALLLGVEIHWGVK
FTGLQPPPRKGSGWRAQLQPNPPAQLASYEFDVLISAAGGKFVPEGFTIREMRGKLAIGI
TANFVNGRTVEETQVPEISGVARIYNQKFFQSLLKATGIDLENIVYYKDETHYFVMTAKK
QCLLRLGVLRQDLSETDQLLGKANVVPEALQRFARAAADFATHGKLGKLEFAQDARGRPD
VAAFDFTSMMRAESSARVQEKHGARLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMV
KRWAEGAGPLEVLAERESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNLRAVTPNQVQ
DLYDMMDKEHAQRKSDEPDSRKTTTGSAGTEELLHWCQEQTAGFPGVHVTDFSSSWADGL
ALCALVHHLQPGLLEPSELQGMGALEATTWALRVAEHELGITPVLSAQAVMAGSDPLGLI
AYLSHFHSAFKNTSHSSGLVSQPSGTPSAILFLGKLQRSLQRTRAKVDEETPSTEEPPVS
EPSMSPNTPELSEHQEAGAEELCELCGKHLYILERFCVDGHFFHRSCFCCHTCEATLWPG
GYGQHPGDGHFYCLQHLPQEDQKEADNNGSLESQELPTPGDSNMQPDPSSPPVTRVSPVP
SPSQPARRLIRLSSLERLRLSSLNIIPDSGAEPPPKPPRSCSDLARESLKSSFVGWGVPV
QAPQVPEAIEKGDDEEEEEEEEEEEEEPLPPLEPELEQTLLTLAKNPGAMTKYPTWRRTL
MRRAKEEEMKRFCKAQAIQRRLNEIEATMRELEAEGTKLELALRKESSSPEQQKKLWLDQ
LLRLIQKKNSLVTEEAELMITVQELDLEEKQRQLDHELRGYMNREETMKTEADLQSENQV
LRKLLEVVNQRDALIQFQEERRLREMPA
Download sequence
Identical sequences Q8VDP3
ENSMUSP00000019967 ENSMUSP00000116386 ENSMUSP00000019967 NP_612188.1.92730 XP_011241439.1.92730 OPTIC8961 10090.ENSMUSP00000019967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]