SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020099 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020099
Domain Number 1 Region: 1-291
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-101
Family Protein kinases, catalytic subunit 0.00000000795
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020099   Gene: ENSMUSG00000019942   Transcript: ENSMUST00000020099
Sequence length 297
Comment pep:known chromosome:NCBIM37:10:68799383:68815686:-1 gene:ENSMUSG00000019942 transcript:ENSMUST00000020099
Sequence
MEDYIKIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLHQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALKHPYFDDLDNQIKKM
Download sequence
Identical sequences P11440
NP_031685.2.92730 ENSMUSP00000020099 10090.ENSMUSP00000020099 ENSMUSP00000020099 ENSMUSP00000020099 ENSMUSP00000113184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]