SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020289 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020289
Domain Number 1 Region: 444-581,610-680,740-813
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.36e-37
Family Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA 0.038
Further Details:      
 
Domain Number 2 Region: 58-192,254-335
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.08e-25
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020289   Gene: ENSMUSG00000020092   Transcript: ENSMUST00000020289
Sequence length 859
Comment pep:known chromosome:NCBIM37:10:60782405:60846271:-1 gene:ENSMUSG00000020092 transcript:ENSMUST00000020289
Sequence
MGTTASTAQQTVSAGTSLEGLQGGSSSSMDSQHSLGGVQSFRATSLHNSKAKSIIPNKVA
PVVITYNCKEEFQIHDELLKAHYRMGRLSDATPEHYLVQGRYFLVRDITEKMDILGTLKS
CGAPNFRQVRGGLPVFGMGQPSLLGFRRVLQKLQTDGLKECIIFCVREEPVVFLRAEEDF
VSYTPRDKESLHENLRDPSPGVKAENLELAIQKEIHDFAQLRDNVYHVYHNTEDLRGEPH
TVAIRGEDGVCVTEEVFKRPLFLQPTYRYHRLPLPEQGAPLEAQFDAFVSVLRETPSLLP
LRDNHGPLPALLFSCQSGVGRTNLGMVLGTLVMFHHSRTTSQLEAASPLAKPLPMEQFQV
IQGFICKVPQGKKMVEEVDRAISACAELHDLKEEVLKNQRRLESFRPESRGQECGSQQAV
QQRALWSLELYFYLLLFNYYLHEQYPLAFALSFSRWLCTHPELYRLLVELNSVGPLVPGD
LIAKGSLEADDLVSLDALSTVREMDVANFRRVPRMPIYGTAQPSAKALGNILAYLSDAKR
KLRQVVWINLREEVVLECDGHTHSLWPPGPALAPEHLEALEAQLKAHLSAPVPNTKSPTA
PRFQKCLTTQEVFSQHQGACLGLTYCRIPVPDFCAPREEDFDRLLEALRAALTKDPGTGF
VFSCLSGQGRTTTAMVVAVLACWHIGGCPEVGEEELVSVPDAKFTKGEFQVVMKVVQLLP
DGHHVKKEVDAALDIVSETMTPMHYHLREIIISTYRQAKATKEAQEAQRLQLRSLQYLER
YIYLILFNAYLRLEKTSSWQRPFSTWMREVATKAGIYEILNQLGFPELESIEEQPLSRLR
YRWQEQSRDPEPCDVGDFL
Download sequence
Identical sequences A0A0R4J007
10090.ENSMUSP00000020289 ENSMUSP00000020289 NP_038781.2.92730 ENSMUSP00000020289 ENSMUSP00000020289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]