SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020649 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020649
Domain Number 1 Region: 26-103,130-227,1188-1278
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6e-26
Family ABC transporter ATPase domain-like 0.019
Further Details:      
 
Domain Number 2 Region: 636-728
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0000667
Family Rad50 coiled-coil Zn hook 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000020649
Domain Number - Region: 893-966
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00806
Family Spectrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020649   Gene: ENSMUSG00000020380   Transcript: ENSMUST00000020649
Sequence length 1312
Comment pep:known chromosome:NCBIM37:11:53463021:53520821:-1 gene:ENSMUSG00000020380 transcript:ENSMUST00000020649
Sequence
MSRIEKMSILGVRSFGIEDKDKQIISFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPG
TKGNTFVHDPKVAQETDVRAQIRLQFRDVNGEMVAVHRSMLCSQKNKKTEFKTLEGVITR
MKHGEKVSLSSKCAEIDREMISCLGVSKSVLNNVIFCHQEDSNWPLSEGKALKQKFDEIF
SATRYIKALDTLRQVRQTQGQKVKECQTELKYLKQNKEKACEIRDQITSKEAQLASSQEI
VRSYEDELEPLKNRLKEIEHNLSKIMKLDNEIKALESRKKQMEKDNSELEQKMEKVFQGT
DEQLNDLYHNHQRTVREKERRLVDCQRELEKLNKEARLLNQEKAELLVEQGRLQLQADRH
QEHIRARDSLIQSLATHLELDGFERGPFSERQIKNFHELVKERQEREAKTASQLLSDLTD
KEALKQRQLDELRDRKSGLGRTIELKTEILTKKQSELRHVRSELQQLEGSSDRILELDQE
LTKAERELSKAEKNSSIETLKAEVMSLQNEKADLDRSLRKLDQEMEQLNHHTTTRTQMEM
LTKDKTDKDEQIRKIKSRHSDELTSLLGYFPNKKQLEDWLHSKSKEINQTRDRLAKLNKE
LASAEQNKNHINNELKKKEEQLSSYEDKLFDVCGSQDLESDLGRLKEEIEKSSKQRAMLA
GATAVYSQFITQLTDENQSCCPVCQRVFQTEAELQEVISDLQSKLRLAPDKLKSTESELK
KKERRRDEMLGLVPVRQSIIDLKEKEIPELRNRLQSVNRDIQRLKNDIEEQETLLGTIMP
EEESAKVCLTDVTIMERFQMELKDVERKIAQQAAKLQGVDLDRTVQQVNQEKQEKQHRLD
TVTSKIELNRKLIQDQQEQIQHLKSKTNELKSEKLQIATNLQRRQQMEEQSVELSTEVQS
LNREIKDAKEQISPLETALEKLQQEKEELIHRKHTSNKMAQDKINDIKEKVKNIHGYMKD
IENYIQDGKDDYKKQKETELNGVAVQLNECEKHREKINKDMGTMRQDIDTQKIQERWLQD
NLTLRKRRDELKEVEEERKQHLKEMGQMQVLQMKNEHQKLEENIDTIKRNHSLALGRQKG
YEDEILHFKKELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKTLDQAIMKFHSMKM
EEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVVMLKGDTALDMRGR
CSAGQKVLASLIIRLALAETFCLNCGILALDEPTTNLDRENIESLAHALVEIIKSRSQQR
NFQLLVITHDEDFVELLGRSEYVEKFYRVKKNMDQCSEIVKCSISSLGSYVH
Download sequence
Identical sequences Q5SV02
ENSMUSP00000020649 NP_033038.2.92730 10090.ENSMUSP00000020649 ENSMUSP00000020649 ENSMUSP00000020649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]