SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020899 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020899
Domain Number 1 Region: 63-258
Classification Level Classification E-value
Superfamily vWA-like 5.7e-55
Family Integrin A (or I) domain 0.00018
Further Details:      
 
Domain Number 2 Region: 261-394
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000471
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 387-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000639
Family EGF-type module 0.022
Further Details:      
 
Domain Number 4 Region: 438-475
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000102
Family Chicken cartilage matrix protein 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020899   Gene: ENSMUSG00000020583   Transcript: ENSMUST00000020899
Sequence length 481
Comment pep:known chromosome:NCBIM37:12:8954735:8978834:1 gene:ENSMUSG00000020583 transcript:ENSMUST00000020899
Sequence
MLLSAPLRHLPGLLLLLWPLLLLPSLAAPGRLARASVRRLGTRVPGGSPGHLSALATSTR
APYSGGRGAGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGATDTRVAVV
NYASTVKIEFQLNTYSDKQALKQAVARITPLSTGTMSGLAIQTAMEEAFTVEAGARGPMS
NIPKVAIIVTDGRPQDQVNEVAARARASGIELYAVGVDRADMESLKMMASKPLEEHVFYV
ETYGVIEKLSARFQETFCALDQCMLGTHQCQHVCVSDGDGKHHCECSQGYTLNADGKTCS
AIDKCALSTHGCEQICVNDRNGSYHCECYGGYALNADRRTCAALDKCASGTHGCQHICVN
DGAGSHHCECFEGYTLNADKKTCSVRNKCALGTHGCQHICVSDGAVAYHCDCFPGYTLND
DKKTCSDIEEARSLISIEDACGCGATLAFQEKVSSHLQKLNTKLDNILKKLKVTEYGQVH
R
Download sequence
Identical sequences O35701
ENSMUSP00000020899 ENSMUSP00000020899 NP_034900.4.92730 10090.ENSMUSP00000020899 ENSMUSP00000020899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]