SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020920 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020920
Domain Number 1 Region: 285-415
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.4e-44
Family Regulator of G-protein signaling, RGS 0.000000151
Further Details:      
 
Domain Number 2 Region: 11-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.71e-27
Family DEP domain 0.0095
Further Details:      
 
Domain Number 3 Region: 220-276
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000000366
Family Transducin (heterotrimeric G protein), gamma chain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020920   Gene: ENSMUSG00000020599   Transcript: ENSMUST00000020920
Sequence length 675
Comment pep:known chromosome:NCBIM37:11:109086669:109159443:-1 gene:ENSMUSG00000020599 transcript:ENSMUST00000020920
Sequence
MTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVRMHNQRVLVTSVPHAMTGGDVLQWIT
QRLWISNLEAQNLGNFIVKYGYIYPLQDPKNLILKPDSSLYRFQTPYFWPTQQWPAEDTD
YAIYLAKRNIKKKGILEEYEKENYDFLNKKINYKWDFVIMQAKEQYRTGKERNKADRYAL
DCQEKAYWLVHRSPPGMNNVLDYGLDRVTNPNEVKKQTVTAVRKEIMYYQQALMRSTVKS
SVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQFWDLNAKLVEIPTKMRVERWAFNF
SELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGAR
RWINIDGKTMDITVKGLRHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKEMLAKAIEP
QETTKRSSTLPFMRRHLRSSPSPVILRQLEEEEKAREAANTVDITQPGQHLAPSPHLAVY
TGTCVPPSPSSPFSPSCRSPRKPFASPSRFIRRPSIAICPSPSRVALEGSSGLEPKGEAS
WSGANSGPSVTENREPSADHSRPQPRAPPKARAALSLGRFLRRGCLASPVFARLSPKCPS
VSHGKVQPLGDMGQQLPRLKPKKVANFFQIKMEMPTDSGTCLMDSDDPRAGESGDQTTEK
EVICPWESLAEGKAG
Download sequence
Identical sequences O54828
ENSMUSP00000020920 10090.ENSMUSP00000020920 ENSMUSP00000020920 ENSMUSP00000020920 NP_035398.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]