SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020922 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020922
Domain Number 1 Region: 55-310
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-49
Family Protein kinases, catalytic subunit 0.000092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020922   Gene: ENSMUSG00000020601   Transcript: ENSMUST00000020922
Sequence length 343
Comment pep:known chromosome:NCBIM37:12:15798533:15823591:-1 gene:ENSMUSG00000020601 transcript:ENSMUST00000020922
Sequence
MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSC
IGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFEISCYQESLAPCFCLSAHSNINQITEIL
LGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRK
FIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSL
GVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQ
EILDHPWFSTDFSVSNSGFGAKEACDQLVPDVNMEENLDPFFN
Download sequence
Identical sequences Q8K4K3
NP_653134.2.92730 XP_006515117.1.92730 XP_021484013.1.76796 ENSMUSP00000020922 10090.ENSMUSP00000020922 ENSMUSP00000020922 ENSMUSP00000020922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]