SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021246 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021246
Domain Number 1 Region: 15-128
Classification Level Classification E-value
Superfamily PX domain 6.67e-32
Family PX domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021246   Gene: ENSMUSG00000020876   Transcript: ENSMUST00000021246
Sequence length 271
Comment pep:known chromosome:NCBIM37:11:96628869:96638845:-1 gene:ENSMUSG00000020876 transcript:ENSMUST00000021246
Sequence
MGLWYRMLENQDLEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRY
REFVWLRKQLQRNAGLVPVPELPGKSTFFGGSDEFIEKRRQGLQHFLEKVLQSVVLLSDS
QLHLFLQSQLSVPEIEACVQGRGAMTVSDAILSYAMSNCGWAQEERQSTSHLAKGDQLNS
CCFLPRSGRRSSPSPPLSEEKEQLETWAPVMDSEGPSSESPTLLPSSSLPACWDPARPEE
GLSVSQPARRAVAADQAGPMEPTQLDTAWDK
Download sequence
Identical sequences Q91WL6
mmt008000673.1 NP_001156861.1.92730 NP_083241.1.92730 XP_006534438.1.92730 XP_011247591.1.92730 ENSMUSP00000021246 10090.ENSMUSP00000021246 ENSMUSP00000021246 ENSMUSP00000021246 ENSMUSP00000103288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]