SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021370 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021370
Domain Number 1 Region: 50-338
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.47e-42
Family FAD-linked reductases, N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021370   Gene: ENSMUSG00000020988   Transcript: ENSMUST00000021370
Sequence length 464
Comment pep:known chromosome:NCBIM37:12:70791423:70825861:-1 gene:ENSMUSG00000020988 transcript:ENSMUST00000021370
Sequence
MWPTLRYVGGVCGLARYCVAGGFLRASGPASGVPGLLCGGGRRSSSTSSFDIVIVGGGIV
GLASARTLILKHPGLSIGVVEKEKDLALHQTGHNSGVIHSGIYYKPESLKAKLCVEGAAL
IYEYCNLKGIPYRQCGKLIVAVEQEEIPRLQALYERGLQNGVEGLRLIQQEDIKKKEPYC
RGLMAIDCPYTGIVNYQQVALSFAQDFQEAGGSILRDFEVKGIEIAKENSSRSKDGMNYP
IAVKNSKGKEIRCRYVVTCAGLYSDRISELSGCNPDPQIVPFRGDYLVLKPEKGYLVKGN
IYPVPDSRFPFLGVHFTPRLDGTIWLGPNAVLAFKREGYRPFDFDARDVMEVILKSGFIN
LVFQHFSYGVNEMYKACFLSETVKHLQKFIPEITISDVLRGPAGVRAQALDRDGNLVEDF
VFDGGTGEIADRVLHVRNAPSPAATSSLAISRMIAEEAQQRFKL
Download sequence
Identical sequences Q91YP0
ENSMUSP00000021370 ENSMUSP00000021370 ENSMUSP00000021370 10090.ENSMUSP00000021370 NP_663418.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]