SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021527 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021527
Domain Number 1 Region: 352-677
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-96
Family Protein kinases, catalytic subunit 0.0000000111
Further Details:      
 
Domain Number 2 Region: 8-138
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.17e-26
Family PLC-like (P variant) 0.0000261
Further Details:      
 
Domain Number 3 Region: 231-298
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.78e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0005
Further Details:      
 
Domain Number 4 Region: 159-224
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.57e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021527   Gene: ENSMUSG00000021108   Transcript: ENSMUST00000021527
Sequence length 683
Comment pep:known chromosome:NCBIM37:12:74685784:74879172:1 gene:ENSMUSG00000021108 transcript:ENSMUST00000021527
Sequence
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTAGTSDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQVNGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDAKIAEQRF
GINIPHKFNVHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLISRSTLRRQGKEGSKEGNGIGVNSSSRFGIDNFEFIRV
LGKGSFGKVMLARIKETGELYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHEKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
TQGGEHEILRHPFFKEIDWAQLNHRQLEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSYVSPELQL
Download sequence
Identical sequences P23298
ENSMUSP00000021527 10090.ENSMUSP00000021527 NP_032882.2.92730 ENSMUSP00000021527 ENSMUSP00000021527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]