SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021642 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021642
Domain Number 1 Region: 289-416
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.97e-41
Family Regulator of G-protein signaling, RGS 0.0000278
Further Details:      
 
Domain Number 2 Region: 3-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.99e-25
Family DEP domain 0.016
Further Details:      
 
Domain Number 3 Region: 214-278
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 5.1e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021642   Gene: ENSMUSG00000021219   Transcript: ENSMUST00000021642
Sequence length 437
Comment pep:known chromosome:NCBIM37:12:84086298:84259755:1 gene:ENSMUSG00000021219 transcript:ENSMUST00000021642
Sequence
MQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIF
PISDHVLTMKDDGTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAEN
LARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEM
DIRKCRRLKNPQKVKKSVYGVTDETQSQSPVHIPSQPIRKTTKDDIRKQITFLNAQIDRH
CLKMSKVAESLIAYTEQYVEYDPFITPAEPSNPWISDDITLWDIEMSKEPSQQRVKRWGF
SFDEILKDQVGRDQFLRFLESEFSSENLRFWLSVQDLKKQPLQDVAKRVEEIWQEFLAPG
APSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKK
KGKSLAGKRLTGLMQSS
Download sequence
Identical sequences A0A087WSH2
ENSMUSP00000021642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]