SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021661 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021661
Domain Number 1 Region: 44-229,353-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.57e-48
Family FAD-linked reductases, N-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021661   Gene: ENSMUSG00000021235   Transcript: ENSMUST00000021661
Sequence length 476
Comment pep:known chromosome:NCBIM37:12:85702918:85714746:1 gene:ENSMUSG00000021235 transcript:ENSMUST00000021661
Sequence
MAARIGSMAGLLCVRWWSSAQLAARGGPLVASQRWAGSSADTVYDVVVSGGGLVGSAMAC
ALGHDIHFHDKKILLLEAGPKKALEKLSETYSNRVSSISPGSTTLLSSFGAWDHICNMRC
KAFRRMQVWDSCSEALIMFDRDNLDDMGYIVENDVIMYALTKQLEAVADRVKVLYESKAV
GYSWPGAFSMADSSPWVHITLGDGSTLQTKLLIGADGHKSGVRQAAGIQNVSWKYDQSAV
VATLHLSEATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHEHAAELVSMDEEEFVDA
INSAFWSDVHHTDFVDSASAMVRHAVALLKPTKVSARQLPPSIAKVDAKSRALFPLGLGH
AAEYVRPRVALIGDAAHRIHPLAGQGVNMGFGDISSLVHHLSTAAFNGKDLGSMSHLTGY
ETDRQRHNTALLAATDLLKRLYSTSATPLVLLRTWGLQATNAVSPLKEQIMAFASK
Download sequence
Identical sequences Q8R1S0
10090.ENSMUSP00000105905 ENSMUSP00000021661 NP_766170.2.92730 XP_006515762.1.92730 ENSMUSP00000021661 ENSMUSP00000105905 ENSMUSP00000021661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]