SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021761 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021761
Domain Number 1 Region: 308-492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-69
Family SPRY domain 0.00000325
Further Details:      
 
Domain Number 2 Region: 91-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.4e-18
Family B-box zinc-binding domain 0.0012
Further Details:      
 
Domain Number 3 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 3.3e-18
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021761   Gene: ENSMUSG00000021326   Transcript: ENSMUST00000021761
Sequence length 513
Comment pep:known chromosome:NCBIM37:13:21272082:21286593:1 gene:ENSMUSG00000021326 transcript:ENSMUST00000021761
Sequence
MASGSVAECLQQETTCPVCLQYFVEPMMLDCGHNICCACLARCWGAAETNVSCPQCRETF
PQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEQDQMPICVVCDR
SREHRGHSVLPLEEAVEGFKEQIQNRLDHLRRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSGLIAQLEEKQ
QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQS
DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCV
LGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL
TSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG
GKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP
Download sequence
Identical sequences A0A061I9N8 A0A1U7R5Y1 Q62158
ENSMUSP00000021761 10090.ENSMUSP00000021761 ENSMUSP00000021761 ENSMUSP00000021761 NP_033080.2.92730 XP_005086721.1.91757 XP_006516669.1.92730 XP_021070983.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]