SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021898 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021898
Domain Number 1 Region: 9-190
Classification Level Classification E-value
Superfamily PH domain-like 2.87e-59
Family Phosphotyrosine-binding domain (PTB) 0.000000172
Further Details:      
 
Domain Number 2 Region: 356-466
Classification Level Classification E-value
Superfamily SH2 domain 1.16e-27
Family SH2 domain 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021898   Gene: ENSMUSG00000021448   Transcript: ENSMUST00000021898
Sequence length 474
Comment pep:known chromosome:NCBIM37:13:51526410:51662453:-1 gene:ENSMUSG00000021448 transcript:ENSMUST00000021898
Sequence
MSATRKSRAGDEPLPRPPRGAPHTSDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQV
TREAISRVCEAVPGAKGALKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPD
SKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQA
FELRFKQYLQCPSKVPALQDRMQSLDEPWTEEEGDGPDHPYYNSVPTKMPPPGGFLDARL
KGRPHAPEAAQFAGKEQTYYQGRHLGDTFGEDWQRAPTRQGSLDIYSTAEGKTHMVPVGE
TPTYVNTQPVPPQVWPAATSSTESSPRKDLFDMKPFEDALRNQPLGPMLSKAASVECISP
VTPRAPDARMLEELNAEPWYQGEMSRKEAEALLREDGDFLVRKSTTNPGSFVLTGMHNGQ
AKHLLLVDPEGTIRTKDRVFDSISHLINYHLESSLPIVSAGSELCLQQPVERKP
Download sequence
Identical sequences Q61120
10090.ENSMUSP00000021898 NP_033193.2.92730 ENSMUSP00000021898 ENSMUSP00000021898 ENSMUSP00000021898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]