SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022504 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022504
Domain Number 1 Region: 12-357
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.25e-94
Family Protein kinases, catalytic subunit 0.00000000000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022504   Gene: ENSMUSG00000021936   Transcript: ENSMUST00000022504
Sequence length 427
Comment pep:novel chromosome:NCBIM37:14:34194235:34260331:-1 gene:ENSMUSG00000021936 transcript:ENSMUST00000022504
Sequence
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAMINGSQHPSSSPSVNDMSSMSTDPTLASDTDSSLEASA
GPLGCCR
Download sequence
Identical sequences G3X8U9
NP_001297382.1.92730 XP_021059139.1.100879 ENSMUSP00000107575 ENSMUSP00000022504 ENSMUSP00000022504 10090.ENSMUSP00000022504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]