SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022508 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022508
Domain Number 1 Region: 128-422
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.13e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022508   Gene: ENSMUSG00000021940   Transcript: ENSMUST00000022508
Sequence length 426
Comment pep:known chromosome:NCBIM37:14:34402456:34453940:1 gene:ENSMUSG00000021940 transcript:ENSMUST00000022508
Sequence
MSSPRKVRGKTGRDNDEEEGNSGNLNLRNSLPSSSQKMTPTKPIFGNKMNSENVKPSHHL
SFSDKYELVYPEPLESDTDETVWDVSDRSLRNRWNSMDSETAGPSKTVSPVLSGSSRLSK
DTETSVSEKELTQLAQIRPLIFNSSARSAMRDCLNTLQKKEELDIIREFLELEQMTLPDD
FNSGNTLQNRDKNRYRDILPYDSTRVPLGKNKDYINASYIRIVNHEEEYFYIATQGPLPE
TIEDFWQMVLENNCNVIAMITREIECGVIKCYSYWPISLKEPLEFEHFSVFLETFHVTQY
FTVRVFQIVKKSTGKSQCVKHLQFTKWPDHGTPASADFFIKYVRYVRKSHITGPLLVHCS
AGVGRTGVFICVDVVFSAIEKNYSFDIMNIVTQMRKQRCGMIQTKEQYQFCYEIVLEVLQ
NLLALY
Download sequence
Identical sequences O55082
NP_033004.1.92730 ENSMUSP00000022508 10090.ENSMUSP00000022508 ENSMUSP00000022508 ENSMUSP00000022508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]