SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022521 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022521
Domain Number 1 Region: 370-688
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-92
Family Protein kinases, catalytic subunit 0.000000000434
Further Details:      
 
Domain Number 2 Region: 2-122
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.96e-24
Family PLC-like (P variant) 0.000000942
Further Details:      
 
Domain Number 3 Region: 218-284
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.98e-23
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000796
Further Details:      
 
Domain Number 4 Region: 141-210
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.68e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022521   Gene: ENSMUSG00000021948   Transcript: ENSMUST00000022521
Sequence length 700
Comment pep:known chromosome:NCBIM37:14:31408544:31423488:-1 gene:ENSMUSG00000021948 transcript:ENSMUST00000022521
Sequence
MAPFLRISFNSYELGSLQVEDEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKTTFD
AHIYEGRVIQIVLMRAAEDPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQY
FLEDGDCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRSSR
KLDTTESVGIYQGFEKKPEVSGSDILGEAGSHISLKLSFPSRAKEKDSSETCDNNGTYGK
IWEGSTRCTLENFTFQKVLGKGSFGKVLLAELKGKDKYFAIKCLKKDVVLIDDDVECTMV
EKRVLALAWESPFLTHLICTFQTKDHLFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAE
IICGLQFLHSKGIIYRDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIA
PEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESK
DIMEKLFERDPDKRLGVTGNIRIHPFFKTINWSLLEKRKVEPPFKPKVKSPSDYSNFDPE
FLNEKPQLSFSDKNLIDSMDQEAFHGFSFVNPKFEQFLDI
Download sequence
Identical sequences 10090.ENSMUSP00000022521 ENSMUSP00000022521 ENSMUSP00000107830 ENSMUSP00000022521 NP_001297611.1.92730 XP_006518758.1.92730 XP_017171407.1.92730 ENSMUSP00000022521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]