SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022563 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022563
Domain Number 1 Region: 122-503
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.01e-144
Family Myotubularin-like phosphatases 0.0000000219
Further Details:      
 
Domain Number 2 Region: 6-112
Classification Level Classification E-value
Superfamily PH domain-like 9.53e-18
Family GRAM domain 0.055
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000022563
Domain Number - Region: 495-542
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0186
Family MED7 hinge region 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022563   Gene: ENSMUSG00000021987   Transcript: ENSMUST00000022563
Sequence length 617
Comment pep:known chromosome:NCBIM37:14:60884065:60921207:1 gene:ENSMUSG00000021987 transcript:ENSMUST00000022563
Sequence
MEHIRTTKVEQVKLLDRFSTNNKSLTGTLYLTATHLLFIDAQQKETWILHHHIASVEKLA
LTTSGCPLVIQCKNFRIVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDTE
RRNGWQLIDLAAEYERMGVPNANWQLSDANREYKVCETYPRELYVPRTASRPVIVGSSNF
RSKGRLPVLSYCRQGTEAAICRCSQPLSGFSARCLEDEHLLQAISKANPGNRYMYVVDTR
PKLNAIANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQKLLEVNGSKGLSVNDFYS
GLESSGWLRHIKAVLDAAIFLAKAIVVENASVLVHCSDGWDRTSQVCSLGSLLLDSYYRT
MKGFMVLIEKDWISFGHKFSERCGHLDGDPREVSPVFTQFLECVWHLTQQFPQAFEFNEA
FLLQIHEHIHSCQFGNFLGNCQKEREELRLKEKTYSLWPFLLDDKKKYLNPLYSSKSQRL
TVLEPNTASFNFKFWRNMYHQFDRTLHPRQSVLSIIMNMNEQSKQLEEDIKDLEAKIKQC
KNGILTKELLHAVHPESPALKTSLCLKEPSLLPVKDTLRAIEGSSPADNRYCDYAEEFSK
SEPTVVSLEYGVARMTC
Download sequence
Identical sequences Q8VE11
10090.ENSMUSP00000022563 ENSMUSP00000022563 ENSMUSP00000022563 ENSMUSP00000022563 354866 NP_659092.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]