SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022977 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022977
Domain Number 1 Region: 122-296,385-494
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.68e-44
Family FAD-linked reductases, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022977   Gene: ENSMUSG00000022351   Transcript: ENSMUST00000022977
Sequence length 572
Comment pep:known chromosome:NCBIM37:15:59146636:59162747:1 gene:ENSMUSG00000022351 transcript:ENSMUST00000022977
Sequence
MWTFLGIATFTYFYKKCGDVTLANKELLLCVLVFLSLGLVLSYRCRHRHGGLLGRHQSGA
QFAAFSDILSALPLIGFFWAKSPESEKKEQLESKKCRKEIGLSETTLTGAATSVSTSFVT
DPEVIIVGSGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGELLQPGGYRVLQELGLGD
TVEGLNAHHIHGYIVHDYESRSEVQIPYPLSETNQVQSGIAFHHGRFIMSLRKAAMAEPN
VKFIEGVVLQLLEEDDAVIGVQYKDKETGDTKELHAPLTVVADGLFSKFRKSLISSKVSV
SSHFVGFLMKDAPQFKPNFAELVLVNPSPVLIYQISSSETRVLVDIRGELPRNLREYMAE
QIYPQLPEHLKESFLEASQNGRLRTMPASFLPPSSVNKRGVLILGDAYNLRHPLTGGGMT
VALKDIKLWRQLLKDIPDLYDDAAIFQAKKSFFWSRKRTHSFVVNVLAQALYELFSATDD
SLHQLRKACFLYFKLGGECVTGPVGLLSILSPHPLVLIRHFFSVAIYATYFCFKSEPWAT
KPRALFSSGAVLYKACSILFPLIYSEMKYLVH
Download sequence
Identical sequences P52019 Q3TQK8
ENSMUSP00000022977 10090.ENSMUSP00000022977 ENSMUSP00000022977 ENSMUSP00000022977 NP_033296.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]