SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000023072 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000023072
Domain Number 1 Region: 9-207,253-363
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.15e-54
Family Calponin-homology domain, CH-domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000023072   Gene: ENSMUSG00000022438   Transcript: ENSMUST00000023072
Sequence length 365
Comment pep:known chromosome:NCBIM37:15:84062473:84146118:1 gene:ENSMUSG00000022438 transcript:ENSMUST00000023072
Sequence
MSSAPPRSPTPRAPKMKKDESFLGKLGGTLARKKKTREVTDLQEEGKSAINSPMAPALVD
IHPEDTQLEENEERTMIDPTSREDPKFKELVKVLLDWINDVLAEERIIVKQLEEDLYDGQ
VLQKLLEKLAHCKLNVAEVTQSEIGQKQKLQTVLEAVQDLLRPHGWPLRWNVDSIHGKNL
VAILHLLVSLAMHFRAPIHLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEIMMGRFER
DAFDTLFDHAPDKLNLVKKSLITFVNKHLNKLNLEVTDLETQFADGVYLVLLLGLLEDYF
VPLHNFYLTPDSFDQKVHNVAFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYTLFTK
YKDVE
Download sequence
Identical sequences Q3UGT9 Q9ES46
ENSMUSP00000023072 ENSMUSP00000023072 10090.ENSMUSP00000023072 ENSMUSP00000023072 NP_573395.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]