SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000023157 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000023157
Domain Number 1 Region: 39-224
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.36e-52
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 421-487
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000499
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000023157   Gene: ENSMUSG00000022515   Transcript: ENSMUST00000023157
Sequence length 655
Comment pep:known chromosome:NCBIM37:16:4941420:4964330:-1 gene:ENSMUSG00000022515 transcript:ENSMUST00000023157
Sequence
MSELSDEASEPELLKRSLSMWHGLGAQGSPEELDVPLDLHTAASIGQHEVVKECVQRGEL
DLNKKNGGGWTALMYASYIGHDTIVHLLLEAGVSVNVPTPEGQTPLMLASSCGNESIAYF
LLQQGAELEMKDIHGWTALFHCTSAGHQQMVKFLLESGANANVREPVYGYTPLMEAAASG
HEIIVQYFLNHGVKVDTRDHSGATACMLARQFGHMKIVALMETHSPVLPKSLYRSPEKYE
DLSSSDESWPVPQRQRPCRKKGLSIHEGPRALAKITAIGLGGKTQTTYEQVPPRGYVTFT
SSDENTMESEGLCYRDVTSPINEQDVESSSSSSREEPTFCASLGPVWRSSSSDGLARAQG
LSSEASIESNEDSDHARKSSVRKQTRSYLKNKSRHGNSDGHWPSSTGPASIPGSEPQTEK
SPYSGPQDLATLLEQIGCLKYLQVFEEQDIDLRIFLTLTESDLKEIGITLFGPKRKMTSA
IARWHSSARPPSDALELAYADRLETEMQELAIQLHKCCEEAEALRGQVSQEQELRAVVES
CLLEQDSARKDIHAQLQEAQTLAQDAALVLDQLRACQAELSARLRQHHSPREGTPNPHFL
SADSKGWPIPLQALSLPELSGALEDRVHEMGQALCSVTQSLEKLQMLNAKKWREP
Download sequence
Identical sequences Q9CZK6
ENSMUSP00000023157 ENSMUSP00000023157 ENSMUSP00000023157 10090.ENSMUSP00000023157 NP_082577.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]