SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000023211 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000023211
Domain Number 1 Region: 340-368
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000848
Family Ran binding protein zinc finger-like 0.0031
Further Details:      
 
Domain Number 2 Region: 233-288
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000611
Family Ubiquitin-related 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000023211   Gene: ENSMUSG00000022552   Transcript: ENSMUST00000023211
Sequence length 380
Comment pep:known chromosome:NCBIM37:15:76177470:76181541:-1 gene:ENSMUSG00000022552 transcript:ENSMUST00000023211
Sequence
MSPPAGGAAVAADPASPVVLLAVHAAVRPLGAGQDAEAQPRKLQLIADPERPGRFRLGLL
GTEPGAVSLEWPLEAICYTVRGPNQHELQPPPGGPGTFSVHFLDPEEAQQWAALVRDATA
EGQNGSGSPAPAPAPAMCPISPPCSSMAQIPKATQPEVDLPQSSGNFKKEELATRLSQAI
AGGDEKAAAQVAAVLAQHHVALNVQLMEAWFPPGPIRLQVTVEDATSVLSSSSSAHVSLK
IHPHCSIAALQDQVFSEFGFPPAVQRWVIGRCLCMPERSLASYGVSQDGDPAFLYLLSAP
REVSGQSLQNSKMDRKLGLFPQSLGLPHDLQPSSSSLPSPSQPGWSCPSCTFINASNRPG
CEMCSTQRPCAWDPLAAAST
Download sequence
Identical sequences Q91WA6
ENSMUSP00000023211 10090.ENSMUSP00000023211 ENSMUSP00000023211 ENSMUSP00000023211 NP_079616.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]