SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000023365 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000023365
Domain Number 1 Region: 29-95
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000021
Family RING finger domain, C3HC4 0.029
Further Details:      
 
Domain Number 2 Region: 171-254
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000496
Family SAM (sterile alpha motif) domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000023365   Gene: ENSMUSG00000022684   Transcript: ENSMUST00000023365
Sequence length 450
Comment pep:known chromosome:NCBIM37:16:13671951:13703705:1 gene:ENSMUSG00000022684 transcript:ENSMUST00000023365
Sequence
MEEPQKNDLSMREQEEEHPVRSSGPQISVSEFSCHCCYDTLVNPTTLNCGHSFCRHCLAL
WWMSSKKTECPECREKWEGFPKVNILLRDAIEKLFPDAIRMRVEDIQQNNDVVQSLAAFQ
KYGNDQNPLAPSTGRVNPQRGGGFFSGVLTALTGVAVILLVYHWRSRESEHGLLVHKAVD
KWTTEEVVLWLEQLGPWASLYRDRFLSERVNGRLLLTLTEEEFSRAPYTIENSSHRRVIL
TELERVRALGVKPPQNLWEYKAVNPGRSLFLLYALKSSPRLGLLYLYLFDYTDCFLPFIH
TICPLQENSSGEDIFTKLLDLREPTWKQWREFLVKYSFLPYQLIAEFAWDWLEVHYWTSR
FLIVNAVLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFMAMFWPLIPQFVCN
CLFYWALYFNPIINIDLVVKEVRRLETQVL
Download sequence
Identical sequences A0A0R4J040
10090.ENSMUSP00000023365 NP_080252.1.92730 ENSMUSP00000023365 ENSMUSP00000023365 ENSMUSP00000023365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]