SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000023497 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000023497
Domain Number 1 Region: 49-279,313-634
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.32e-144
Family Leishmanolysin 0.0000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000023497   Gene: ENSMUSG00000022802   Transcript: ENSMUST00000023497
Sequence length 681
Comment pep:known chromosome:NCBIM37:16:33062607:33127781:1 gene:ENSMUSG00000022802 transcript:ENSMUST00000023497
Sequence
MAAAGSGGAGGPGPGPRGRWGGCLWVRGVLLVLGGLPAGAGAAPVSLGTSPPCRHHVLSD
TEVINKVHLKTNHVTKRDADGHLRIKTIYDQSIEELLPEKRYLVKNKLFPQAISYLEKTF
QVRRPAGRILLSRQCATNQYLRKENDPHRYCTGECAVHTKCGPVIVPEEHLQQCRVCREG
KWPCGAVGVLDPEGVRDADFVLYVGALATERCSHENIISYAAYCQQEAKMDRPIAGYANL
CPNMISTQPQEFIGMLSTVKHEIIHALGFSAGLFAFYHDQDGNPLTSRSADGLPPFNYSL
GLYQWSDKVVRKVERLWNVRDNKIVRHTVYLLVTPRVVEEARKHFNCPVLEGMELENQGG
MGTELNHWEKRLLENEAMTGSHTQNRVLSRITLALMEDTGWYKANYSMAEKLDWGRGLGC
EFVRKSCKFWIDQHRQRRQVPSPYCDTLRSNPLQLTCRQDQRAVAVCNLQRFPNPLPPEY
QYFDELTGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPELFKNY
GAEQYGPHSVCLLQKSAFIMEQCERKLSYPDWGSGCYQVSCSPQGLKVWVQDTSYLCSRA
GQVLPVRIQMNGWIHNGNLLCPSCWDFCEQCPPETDPPAANLTRALPLDLCSCSSSLVVT
LWLLLGNLFPLLAGFLLCVWH
Download sequence
Identical sequences Q8BMN4
ENSMUSP00000023497 NP_766411.1.92730 ENSMUSP00000023497 ENSMUSP00000023497 10090.ENSMUSP00000023497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]