SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000023756 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000023756
Domain Number 1 Region: 360-541
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.03e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 281-338
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000628
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000023756
Domain Number - Region: 31-104
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0335
Family FCH domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000023756   Gene: ENSMUSG00000023015   Transcript: ENSMUST00000023756
Sequence length 628
Comment pep:known chromosome:NCBIM37:15:99450928:99482087:-1 gene:ENSMUSG00000023015 transcript:ENSMUST00000023756
Sequence
MDTTMVNLWTLFEQLVRRMEIINEGNESIEFIQVVKDFEDFRKKYQRTNQELEKFKDLLL
KAETGRSALDVKLKHARNQVDVEIKRRQRAEAECAKLEQQIQLIRDILMCDTSGSIQLSE
EQKSALAFLNRGQASSGHAGNNRLSTIDESGSILSDISFDKTDESLDWDSSLVKNFKMKK
REKRRSNSRQFIDGPPGPVKKTCSIGSTVDQANESIVAKTTVTVPSDGGPIEAVSTIETL
PSWTRSRGKSGPLQPVNSDSALNSRPLEPRTDTDNLGTPQNTGGMRLHDFVSKTVIKPES
CVPCGKRIKFGKLSLKCRDCRLVSHPECRDRCPLPCIPPLVGTPVKIGEGMLADFVSQAS
PMIPAIVVSCVNEIEQRGLTEAGLYRISGCDRTVKELKEKFLKVKTVPLLSKVDDIHVIC
SLLKDFLRNLKEPLLTFWLSKAFMEAAEITDEDNSTAAMYQAVSELPQANRDTLAFLMIH
LQRVSQSPDTKMDIANLAKVFGPTIVAHTVPNPDPVTMFQDIKRQLKVVERLLSLPLEYW
NQFMMVDQENIDSQRGNGNSTPRTPDVKVSLLGPVTTPEFQLVKTPLSSSLSQRLYNLSK
STPRFGNKSKSATNLGQQGKFFPAPYLK
Download sequence
Identical sequences Q9WVM1
ENSMUSP00000023756 ENSMUSP00000126417 10090.ENSMUSP00000023756 NP_001240737.1.92730 NP_001240738.1.92730 NP_036155.1.92730 XP_011243948.1.92730 ENSMUSP00000023756 ENSMUSP00000023756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]