SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000024599 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000024599
Domain Number 1 Region: 317-461
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.35e-43
Family Mannose 6-phosphate receptor domain 0.000000502
Further Details:      
 
Domain Number 2 Region: 165-313
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.84e-43
Family Mannose 6-phosphate receptor domain 0.000000201
Further Details:      
 
Domain Number 3 Region: 620-754
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.32e-39
Family Mannose 6-phosphate receptor domain 0.00053
Further Details:      
 
Domain Number 4 Region: 1361-1500
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.24e-35
Family Mannose 6-phosphate receptor domain 0.00038
Further Details:      
 
Domain Number 5 Region: 1216-1355
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-33
Family Mannose 6-phosphate receptor domain 0.00013
Further Details:      
 
Domain Number 6 Region: 1508-1639
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.27e-33
Family Mannose 6-phosphate receptor domain 0.000000282
Further Details:      
 
Domain Number 7 Region: 474-611
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.97e-32
Family Mannose 6-phosphate receptor domain 0.0013
Further Details:      
 
Domain Number 8 Region: 39-161
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.1e-32
Family Mannose 6-phosphate receptor domain 0.00000131
Further Details:      
 
Domain Number 9 Region: 752-916
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-31
Family Mannose 6-phosphate receptor domain 0.002
Further Details:      
 
Domain Number 10 Region: 1060-1211
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.62e-30
Family Mannose 6-phosphate receptor domain 0.0013
Further Details:      
 
Domain Number 11 Region: 2125-2272
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.44e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 12 Region: 1644-1789
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.49e-29
Family Mannose 6-phosphate receptor domain 0.0013
Further Details:      
 
Domain Number 13 Region: 1980-2118
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-28
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 
Domain Number 14 Region: 926-1070
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.44e-22
Family Mannose 6-phosphate receptor domain 0.0028
Further Details:      
 
Domain Number 15 Region: 1792-1887,1938-1981
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.22e-22
Family Mannose 6-phosphate receptor domain 0.0031
Further Details:      
 
Domain Number 16 Region: 1888-1936
Classification Level Classification E-value
Superfamily Kringle-like 1.66e-16
Family Fibronectin type II module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000024599   Gene: ENSMUSG00000023830   Transcript: ENSMUST00000024599
Sequence length 2483
Comment pep:known chromosome:NCBIM37:17:12875272:12962530:-1 gene:ENSMUSG00000023830 transcript:ENSMUST00000024599
Sequence
MRAVQLGPVPSGPRVALLPPLLLLLLLAAAGSAQAQAVDLDALCSYTWEAVDSKNNAVYK
INVCGNVGISSCGPTSAICMCDLKTENCRSVGDSLLRSSARSLLEFNTTMGCQPSDSQHR
IQTSITFLCGKTLGTPEFVTATDCVHYFEWRTTAACKKDIFKADKEVPCYAFDDKLQKHD
LNPLIKLNGGYLVDDSDPDTSLFINVCRDIDSLRDPSTQLRVCPAGTAACLLKGNQAFDV
GRPKEGLKLLSKDRLVLTYVKEEGEKPDFCNGHSPAVTVTFVCPSERREGTIPKLTAKSN
CRYEVEWITEYACHRDYLQSESCSLSSEQHDITIDLSPLAQYGGSPYVSDGREYTFFINV
CGDTKVSLCNNKEAAVCQEKKADSTQVKIAGRHQNQTLRYSDGDLTLIYSGGDECSSGFQ
RMSVINFECNKTAGKDGRGEPVFTGEVDCTYFFTWDTKYACIKEKEDLLCGAINGKKRYD
LSVLARHSESEQNWEAVDGSQAESEKYFFINVCHRVLQEGKARNCPEDAAVCAVDKNGSK
NLGKFVSSPTKEKGHIQLSYTDGDDCGSDKKISTNITLVCKPGDLESAPVLRAARSDGCF
YEFEWHTAAACVLSKTEGENCTVLDAQAGFSFDLSLLTKKNGAYKVETEKYDFYINVCGP
VSMDPCQSNSGACQVAKSGKSWNLGLSSTKLTYYDGMIQLSYRNGTPYNNEKHTPRATLI
TFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECMVTDPSMMEQYDLSSLVKSE
GGSGGNWYAMENSREHVTRRKYYLNVCRPLNPVPGCDRYASACQMKYENHEGSLAETVSI
SNLGVAKIGPVVEESGSLLLEYVNGSACTTSDGQLTTYSTRIHLVCGRGFMNSHPIFTFN
WECVVSFLWNTEAACPIQTITETDQACSIRDPSSGFVFNLSPLNDSAQGHVVLGIGKTFV
FNICGAMPACGTVAGKPAYGCEAETQIEDIKDLRPQRPVGMERSLQLSAEGFLTLTYKGS
SPSDRGTAFIIRFICNDDIYPGAPKFLHQDIDSTRGIRNTYFEFETALACTPSLVDCQVT
DPAGNEYDLSALSMVRKPWTAVDTSAYGKRRHFYLSVCNPLPYIPGCHGIALGSCMVSED
NSFNLGVVQISPQATGNGSLSILYVNGDRCGDQRFSTRIVFECAQTSGSPMFQFVNNCEY
VFVWRTVEACPVIREEGDNCQVKDPRHGNLYDLKPLGLNDTIVSVGEYTYYLRVCGKLSS
DVCSAHDGSKAVSSCQEKKGPQGFQKVAGLLSQKLTFENGLLKMNYTGGDTCHKVYQRST
TIYFYCDRTTQKPVFLKETSDCSYMFEWRTQYACPPFNVTECSVQDAAGNSIDLSSLSRY
SDNWEAVTRTGATEHYLINVCKSLSPHAGTEPCPPEAAVCLLNGSKPVNLGKVRDGPQWT
DGVTVLQYVDGDLCPDKIRRRSTIIRFTCSDNQVNSRPLFISAVQDCEYTFSWPTPSACP
VKSNTHDDCQVTNPSTGHLFDLSSLSGRAGINASYSEKGLVFMSICEENENCGPGVGACF
GQTRISVGKASKRLSYKDQVLQLVYENGSPCPSLSDLRYKSVISFVCRPEAGPTNRPMLI
SLDKQTCTLFFSWHTPLACEQATECTVRNGSSIIDLSPLIHRTGGYEAYDESEDDTSDTT
PDFYINICQPLNPMHGVPCPAGASVCKVPVDGPPIDIGRVTGPPIFNPVANEVYLNFESS
THCLADRYMNYTSLITFHCKRGVSMGTPKLIRTNDCDFVFEWETPIVCPDEVKTQGCAVT
DEQLLYSFNLTSLSTSTFKVTRDARTYSIGVCTAAAGLGQEGCKDGGVCLLSGNKGASFG
RLASMQLDYRHQDEAVILSYVNGDPCPPETDDGEPCVFPFIYKGKSYDECVLEGRAKLWC
SKTANYDRDHEWGFCRQTNSYRMSAIIFTCDESEDIGRPQVFSEDRGCEVTFEWKTKVVC
PPKKMECKFVQKHKTYDLRLLSSLTGSWDFVHEGNSYFINLCQRVYKGPLDCSERASICK
KSATGQVQVLGLVHTQKLEVIDETVIVTYSKGYPCGGNKTASSVIELTCAKTVGRPAFKR
FDSVSCTYYFYWYSRAACAVRPQEVTMVNGTLTNPVTGKSFSLGEIYFKLFSASGDMRTN
GDNYLYEIQLSSITSSSYPACAGANICQVKPNDQHFSRKVGTSDMTKYYVQDGDLDVVFT
SSSKCGKDKTKSVSSTIFFHCDPLVKDGIPEFSHETADCQYLFSWYTSAVCPLGVDFEDE
SAGPEYKGLSERSQAVGAVLSLLLVALTGCLLALLLHKKERRETVINKLTSCCRRSSGVS
YKYSKVSKEEETDENETEWLMEEIQVPAPRLGKDGQENGHITTKAVKAEALSSLHGDDQD
SEDEVLTVPEVKVHSGRGAEVESSQPLRNPQRKVLKEREGERLGLVRGEKARKGKFRPGQ
RKPTAPAKLVSFHDDSDEDLLHI
Download sequence
Identical sequences Q07113
NP_034645.2.92730 ENSMUSP00000024599 ENSMUSP00000024599 10090.ENSMUSP00000024599 ENSMUSP00000024599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]