SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000024843 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000024843
Domain Number 1 Region: 303-445
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 199-304
Classification Level Classification E-value
Superfamily Second domain of FERM 1.02e-36
Family Second domain of FERM 0.00000297
Further Details:      
 
Domain Number 3 Region: 118-198
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.03e-27
Family First domain of FERM 0.0000992
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000024843   Gene: ENSMUSG00000024044   Transcript: ENSMUST00000024843
Sequence length 1087
Comment pep:known chromosome:NCBIM37:17:69506150:69639325:1 gene:ENSMUSG00000024044 transcript:ENSMUST00000024843
Sequence
MTTESGSDSESKPDQEAEPQEAAGPQGQAGAQPGPEPAGGNGSLNGEKQQPALEQFPEAA
AHSTPVKREIGDKDRDFAAAAAKQLEYQQFEDDKLSQRSSSSKLSRSPLKIVKRPKSMQC
KVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIK
KQIRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYT
VQSELGDYDPDECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKK
LSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIR
PGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRT
QAQTRRASALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEK
KAEEERVEEEDRRKKAEEATPVTALRHEGKSPPGHGAADSCPPSPPSAHPDPPPPTELRR
RCKEKERAEPSSLESEAQGKAYLGDQDVAFSYRQPAGKGTTLFSFSLQLPESFPSLLDED
GYLSFPNLSETNLLPQSWQHFLPIRSPSLLPCFLFIFFFLLSASFSVPYALTLSFPLALC
LCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAADGETSATESDQEEDAEIKAQDLDK
TQDELMKHQTNISELKRTFLETSTETALTNEWEKRLSTSPVRLAARQEDAPMIEPLVPEE
TKQSSGEKLMDGSEILSLLESARKPTEFIGGVSSTTQSWVQKLETKTEPVEAEVESTPHP
QPLSTEKVLQETILVEERHVMSVHASGDASHTARDEVDAAESTPTDRRHTGKGKEGSSVT
EAAKEQRGEEVDQSAPEQEQPATVSHEEEQASTIRTSEGLEQKSHFESSTVRVESTSVGS
ISPGGAKLEISTKEVPVVHTETKTITYESSQVDPGADLEPGVLMSAQTITSETTSTTTTT
HITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI
TPEDGED
Download sequence
Identical sequences 10090.ENSMUSP00000024843 XP_011244584.1.92730 ENSMUSP00000024843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]