SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025020 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025020
Domain Number 1 Region: 290-420
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.57e-43
Family Regulator of G-protein signaling, RGS 0.00000277
Further Details:      
 
Domain Number 2 Region: 16-118
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.01e-26
Family DEP domain 0.0069
Further Details:      
 
Domain Number 3 Region: 216-278
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.18e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025020   Gene: ENSMUSG00000024186   Transcript: ENSMUST00000025020
Sequence length 466
Comment pep:known chromosome:NCBIM37:17:26339907:26348269:1 gene:ENSMUSG00000024186 transcript:ENSMUST00000025020
Sequence
MAMVTRCTPHGGCSRMQRPHLSKMERVVVSMQDPDQGVKMRSQRLLITVIPHAVAGRDLV
EWLVQKFCILEDEALHLGTLLAQHGYIYPLRESRDLTLRPDETPYRFQTPYFWTSTMWPA
AELDYAIYLAKKNIQKQGALVDYEKEHYALLHKKINHAWDLVLMQAREQLRAAKQRRKGD
RMVISCQEQTYWLVNKPPPGAPNILEQGPERGSYNPSHMQMSSDFYKCEIECFRKALGRN
RVKSSACLEAYLKFSSQHGPHDPIMSGCLPSNPWITDDVTYWAMNAPNVAAPTKLRVERW
SFSFRELLDDPVGRAHFMDFLQKEFSAENLSFWEACEELRFGGQAQVPTLVDSVYQQFLA
PGAARWINIDSRTMERTLEGLRQPHRYVLDAAQLHIYMLMKKDSYPRFLKSDIYKGLLEE
AVIPLETKRWPFPFLRKPLHSSPSPALQSTPREPAATSSPEGADGE
Download sequence
Identical sequences G3X8W6
ENSMUSP00000025020 10090.ENSMUSP00000025020 NP_001074538.1.92730 ENSMUSP00000113885 ENSMUSP00000025020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]