SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025025 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025025
Domain Number 1 Region: 164-312
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-44
Family Dual specificity phosphatase-like 0.00000285
Further Details:      
 
Domain Number 2 Region: 3-142
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.49e-24
Family Cell cycle control phosphatase, catalytic domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025025   Gene: ENSMUSG00000024190   Transcript: ENSMUST00000025025
Sequence length 367
Comment pep:known chromosome:NCBIM37:17:26642535:26645464:-1 gene:ENSMUSG00000024190 transcript:ENSMUST00000025025
Sequence
MVMEVGILDAGGLRALLREGAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSASLDGAKRDGTLALAAGALCREARSTQVFF
LQGGYEAFSASCPELCSKQSTPTGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILSF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKDAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHPTNSALNYLKSP
ITTSPSC
Download sequence
Identical sequences P28563 Q3U8K3
ENSMUSP00000025025 NP_038670.1.92730 ENSMUSP00000025025 10090.ENSMUSP00000025025 NYSGXRC-8651b ENSMUSP00000025025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]