SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025054 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025054
Domain Number 1 Region: 234-323
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.27e-34
Family ets domain 0.0000106
Further Details:      
 
Domain Number 2 Region: 105-204
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.71e-28
Family Pointed domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025054   Gene: ENSMUSG00000024215   Transcript: ENSMUST00000025054
Sequence length 325
Comment pep:known chromosome:NCBIM37:17:27851392:27865896:-1 gene:ENSMUSG00000024215 transcript:ENSMUST00000025054
Sequence
MGSASPGLSNVSPGCLLLFPDVAPRTGTEKAASGAMGPEKQEWSPSPPATPEQGLSAFYL
SYFNMYPDDSSWVAKVPEARAGEDHPEEPEQCPVIDSQASGSTLDEHSLEQVQSMVVGEV
LKDIETACKLLNITADPGDWSPGNVQKWLLWTEHQYRLPPAGKAFQELGGKELCAMSEEQ
FRQRAPLGGDVLHAHLDIWKSAAWMKERTSPGTLHYCASTSEEGWTDGEVDSSCSGQPIH
LWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGVRKNRPAMNYDKLSRSIR
QYYKKGIIRKPDISQRLVYQFVHPV
Download sequence
Identical sequences Q9WTP3
ENSMUSP00000025054 ENSMUSP00000025054 ENSMUSP00000025054 ENSMUSP00000110520 ENSMUSP00000127056 NP_038919.1.92730 XP_006524442.1.92730 XP_006524443.1.92730 XP_006524444.1.92730 XP_017172988.1.92730 10090.ENSMUSP00000025054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]