SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025234 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025234
Domain Number 1 Region: 101-206
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-35
Family Second domain of FERM 0.0000543
Further Details:      
 
Domain Number 2 Region: 204-350
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-35
Family Third domain of FERM 0.00066
Further Details:      
 
Domain Number 3 Region: 9-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.65e-19
Family First domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025234   Gene: ENSMUSG00000024376   Transcript: ENSMUST00000025234
Sequence length 686
Comment pep:known chromosome:NCBIM37:18:33955981:34166860:-1 gene:ENSMUSG00000024376 transcript:ENSMUST00000025234
Sequence
MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFRHINLVEIDYFGLR
YCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVK
QDALQGRLPCPVNIAAQMGAYAIQAELGDHDPYKHTAGYVSEYRFVPDQKEELEEAIERI
HKTLMGQAPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPSGVVVYKNKKQVG
KYFWPRITKVHFKETQFELRVLGKDCNETSFFFEARSKTACKHLWKCSVEHHTFFRMPDT
ESNSLSRKLSKFGSISYKHRYSGRTALQMSRDLSIQLPRPNQNVVRSRSKTYPKRVAQTQ
PTGSNNINRITANTENGENEGTTKIIAPSPVKSFKKAKNENSPDPQRSKSHAPWEENGPQ
SGLYNSSSDRTKSPKFPCARQRNLSCGSDNDSSQLMRRRKAHNSGEDSDLKQRRRSRSRC
NTSSGSESENSNREHRKKRNRTRQENDMVDSGPQWEAVLRRQKEKNQADPNNRRSRHRSR
SRSPDIQAKEELWKHIQKELVDPSGLSEEQLKEIPYTKVETQGDPVRIRHSHSPRSYRQY
RRSQCSDGERSVLSEVNSKTDLVPPLPVTRSSDAQGSGGSTVHQRRNGSKDSLIEEKSQL
STINPAGKPTAKTIKTIQAARLKAET
Download sequence
Identical sequences P52963
NP_038540.2.92730 10090.ENSMUSP00000025234 ENSMUSP00000025234 ENSMUSP00000025234 ENSMUSP00000025234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]