SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025472 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025472
Domain Number 1 Region: 28-347
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-22
Family FAD-linked reductases, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025472   Gene: ENSMUSG00000024579   Transcript: ENSMUST00000025472
Sequence length 495
Comment pep:known chromosome:NCBIM37:18:61856491:61867289:-1 gene:ENSMUSG00000024579 transcript:ENSMUST00000025472
Sequence
MARAAPLLAVLATVLTTAAAGGDAPPGKIAVIGAGIGGSAVAHFLQQHFGPRVQIVVYEK
GTVGGRLATISVNKQNYESGAASFHSLSLHMQDFVKLLGLRQRREVVGRSAIFGGEHFVL
EETDWYLLNLFRLWWYYGISFLRLQMWVEEVMEKFMRIYKYQAHGYAFSGVEELLYSLGE
ATFVNMTQRSVAESLLQVGVTQRFIDDVVSAVLRASYGQSASMPAFAGAMSLAGAQGNLW
SVEGGNKLVCSGLLKLAKATVIHATVTSVTLHSTEGKALYQVAYESDKGNSSDFYDIVVI
ATPLHLDNSSNNNITFEGFTPPIEDIQGSFQPTVVSLVHGYLNSSYFGFPDPKLFPFANI
LTTDFPSFFCTLDNICPVNISASFRRKQPQEAAVWRVQSPKPLFRTELKTLFRSYYSVQT
AEWQAHPLYGSRRTLPRFALHDQLFYLNALEWAASSVEVTAVAAKNVALLAYNRWYQDLD
KIDQKDLIHKVKTEL
Download sequence
Identical sequences Q8C7K6
NP_766420.1.92730 ENSMUSP00000025472 ENSMUSP00000025472 ENSMUSP00000025472 10090.ENSMUSP00000025472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]