SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025681 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025681
Domain Number 1 Region: 68-409
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-80
Family Protein kinases, catalytic subunit 0.00000319
Further Details:      
 
Domain Number 2 Region: 875-926
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000778
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0073
Further Details:      
 
Domain Number 3 Region: 942-1064
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000763
Family Pleckstrin-homology domain (PH domain) 0.046
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000025681
Domain Number - Region: 631-668
Classification Level Classification E-value
Superfamily XRCC4, C-terminal oligomerization domain 0.00288
Family XRCC4, C-terminal oligomerization domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025681   Gene: ENSMUSG00000024769   Transcript: ENSMUST00000025681
Sequence length 1551
Comment pep:known chromosome:NCBIM37:19:6306456:6325652:1 gene:ENSMUSG00000024769 transcript:ENSMUST00000025681
Sequence
MEQRLRALEQLVRGEAGGSPGLDGLLDLLLGVHQELSSAPLRRERNVAQFLSWASPFVTK
VKELRLQRDDFEILKVIGRGAFGEVAVVRQRGSGQIFAMKMLHKWEMLKRAETACFREER
DVLVKGDSRWVTALHYAFQDEEYLYLVMDYYAGGDLLTLLSRFEDRLPPELAQFYLAEMV
LAIHSLHQLGYVHRDVKPDNILLDMNGHIRLADFGSCLRLNNNGMVDSSVAVGTPDYISP
EILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYAESLVETYGKIMNHEDHLQFPAD
VTDVPASAQDLIRQLLCRQEERLGRGGLDDFRKHPFFEGVDWERLATSTAPYIPELRGPM
DTSNFDVDDDTLNRPETLPPSSHGAFSGHHLPFVGFTYTSGSPFDVQSSELMAAPEGTPH
CVEQVKVELSHKCQEPLHGPLQPQELVRLQKEVQVLQEKLAETLRDSKASLSQTDGLHAR
SPAPNIQLQQEKDRLQQELTEAQAALRVQDAELCQAQNRQEEFLQRLWEAQEREAAAASQ
IQALNSQLEEAWVVRRELEGQVTTLSQEVTRLQGQCKQESSQAKTVHAAPETNGIGSPEG
QSQEAQLRKEVAALREQLEHACSQGISVGKEEVLCRLQEENQRLSREQERLAGELELELQ
SKQRLEGERRETESNWEAQIADILSWVNDEKVSRGYLQALATKMAEELESLRNVGTQTLP
TRPLDHQWKARRLQKMEASARLELQSALEAEIRAKQSLQEQLTQVQEAQRQAERRLQEAE
KQSQALQQEVAELREELQARGPGDARPSTSLIPLLSFWNTEKDSAKDPGNSGEGPRSGAE
AELRPEGRRSLRMGSVFPRVPAATTTPAEGPPAKPGSHTLRPRSFPSPTKCLRCTSLMLG
LGRQGLGCDTCGYFCHSACASQAPPCPVPPELLRTALGVHPETGTGTAYEGFLSVPRPSG
VRRGWQRVYAALSDSRLLLFDAPDPRGSLASGVLLQALDLRDPQFSATPVLAPDVIHAQS
KDLPRIFRVTASQLTVPPTTCTVLLLAENEGERERWLQVLGELQRLLLDARPRPRPVYTL
KEAYDNGLPLLPHALCAAVIDQERLALGTEEGLFVIHLHSNDIFQVGDCRRVQRLAVSSA
AGLLAVLCGRGPSVRLFALDELESAEVAGAKIPESRGCQALVAGRILQARTPVLCVAVKR
QVLCYQLGPGPGPWQRRIRELQAPAPVQSLGLLGDRLCVGAAGTFALYPLLNEAAPLALG
TGLVAEELPASRGGLGEALGAVELSLSELLLLFATAGVYVDSAGRKSRSHELLWPAAPTG
WGYTAPYLTVFSENALDVFDVRRAEWVQTVPLKKVRPLNPEGSLFLYGTEKVRLTYLRNP
LAEKDEFDIPDLTDNSRRQLFRTKSKRRFFFRVSDELRQQQRREMLKDPFVRSKFISPPT
NFNHLVHVGPTEGRPNTRDGTRAQEQKSRGARSSGPQRPHSFSEAFRRPVSTGSDGLPGE
TDPLVKRKPWTSLSSESVSCPQGSLSPAASLIQVSERPRSLPPDPESESSP
Download sequence
Identical sequences Q80UW5
ENSMUSP00000025681 NP_001028514.1.92730 ENSMUSP00000025681 ENSMUSP00000025681 10090.ENSMUSP00000025681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]