SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025728 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025728
Domain Number 1 Region: 127-268
Classification Level Classification E-value
Superfamily Second domain of FERM 5.89e-17
Family Second domain of FERM 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025728   Gene: ENSMUSG00000024816   Transcript: ENSMUST00000025728
Sequence length 466
Comment pep:known chromosome:NCBIM37:19:5849702:5875274:-1 gene:ENSMUSG00000024816 transcript:ENSMUST00000025728
Sequence
MEGAEGNAGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLSSISAHELHRA
VREVLQLPDVALEAFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTNASDDDVAMDE
PSLQFRRNVFFPRRRELQIHDEEVLRLLYEEAKGNVLTARYPCDLEDCEVLGGLVCRVQL
GPYQPGQPAACTLREKLDSFLPAHLCKRGHGLFAAFRGRGAKTGPGEQGLLNAYRQVKEV
TGNNSEREATLGSHYRAYLLKCHELPFYGCAFFHGEVDKPAQGFLHRGGRKPVTVAISLE
GVHVIDNREKHVLLGLRFQELSWDHTSPEEEEPVLWLEFDGDSEGTPVNKLLRIYSKQAE
LMSGLIEYCIELSQAAEPTLSQESASGPHEAPSPSPPPTQRPKLRRQGSVVCSRIQHLST
IDYVEDGKGIKRVKPKRTTSFFSRQLSSSQGSYTVVQPTDDSLEQS
Download sequence
Identical sequences Q3UFK8
ENSMUSP00000025728 10090.ENSMUSP00000025728 ENSMUSP00000025728 ENSMUSP00000025728 NP_080445.1.92730 XP_006531891.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]